Protein Info for ABCV34_RS00400 in Castellaniella sp019104865 MT123

Annotation: tRNA lysidine(34) synthetase TilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF01171: ATP_bind_3" amino acids 35 to 216 (182 residues), 143.7 bits, see alignment E=5.6e-46 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 35 to 220 (186 residues), 132.9 bits, see alignment E=6.5e-43 PF09179: TilS" amino acids 268 to 336 (69 residues), 44 bits, see alignment E=2.3e-15

Best Hits

Swiss-Prot: 56% identical to TILS_BORBR: tRNA(Ile)-lysidine synthase (tilS) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 57% identity to put:PT7_0214)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>ABCV34_RS00400 tRNA lysidine(34) synthetase TilS (Castellaniella sp019104865 MT123)
MKPVAADRWCATYDDDLLTAVRVALADVPAGAALGVALSAGADSAMLALHAARVAADTGR
HLHCFHIHHGLQASADEWLNQAHRLAGLIGVSCHSRRVRVDAQGTGMEAAARAARYAALA
DLAAQAGVGHVLLAHHQDDQAETVLLRLLRGAGPLGLGAMAPVMRRDDLLYLRPWLDQPR
SHILQAADRFAAISGWQPVHDPSNRDARYARGAVRADLAPVLDGRWPAWRRTLARHARQA
RELEQWALDAVREDWPRLDPDADGLGFSLASWRLLPASRQAPVLRFWLRSQGLRMPTEAR
LDAWLKQLREVHALGHDRQVRLRHESHWIVVQKGRVLLVPETSSKPS