Protein Info for ABCV34_RS00335 in Castellaniella sp019104865 MT123

Annotation: transporter substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF00497: SBP_bac_3" amino acids 13 to 228 (216 residues), 227.2 bits, see alignment E=3.6e-71 PF10613: Lig_chan-Glu_bd" amino acids 32 to 104 (73 residues), 44.1 bits, see alignment E=4.2e-15 PF12974: Phosphonate-bd" amino acids 39 to 215 (177 residues), 37.3 bits, see alignment E=4.5e-13 PF09084: NMT1" amino acids 62 to 141 (80 residues), 21.6 bits, see alignment E=3.6e-08

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 75% identity to axy:AXYL_02853)

Predicted SEED Role

"Glutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2)" (TC 3.A.1.3.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>ABCV34_RS00335 transporter substrate-binding domain-containing protein (Castellaniella sp019104865 MT123)
MGASATSQAAGTIRAVTDPTFPPMEFTEAGHRTGFDIDLTTALAKEMGKTIEWTDIDFKG
LIPAILSGRADMAVSAIYITPERKQVVDFTDSYYAGGLVVLTKKDGPIKTLKDLAGKKVS
VQVGTKSVKYLQDHYPQAQRVEVEKNEEMFNLVEVGRADAAVTGKPAAKRYAQSHPNLTV
LNEQVTTEEYGFAVSKNEPQLTKDLNAALARLKANGTYDKIVVKWFGEGHQ