Protein Info for DvMF_3185 in Desulfovibrio vulgaris Miyazaki F

Annotation: phosphate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 137 to 164 (28 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 303 to 331 (29 residues), see Phobius details PF01384: PHO4" amino acids 22 to 322 (301 residues), 319.4 bits, see alignment E=1.4e-99

Best Hits

Swiss-Prot: 46% identical to PIT_BACSU: Probable low-affinity inorganic phosphate transporter (pit) from Bacillus subtilis (strain 168)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to dvm:DvMF_3185)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNH9 at UniProt or InterPro

Protein Sequence (336 amino acids)

>DvMF_3185 phosphate transporter (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLEIPVLLVVIVIVALIFDFTNGAHDCANAIATVVSTKVLSPRTAVAMAAVLNLFGAMLG
EEVAHTLGQGIVNTNMVAGSQTLVLAALIGAIAWNLITWYYGLPSSSSHALIGGLMGAAI
THAGFSTLNAMSIVKKILLPLVLSPLAGFAVSYACMMLLMLLFWRTNRRTVTRSFEKLQI
VSSAFMATSHGLNDAQKTMGVITLALFLFHQIDTIHVPLWVKLSCALAMAMGTALGGWKI
VKTMGHKIFKLEPVHGFAAETSAAVVITGASLMGAPISTTHTITACVFGVGATKRLSAVR
WGIAGNLVVAWILTIPAAATMASISFLILELLGIAD