Protein Info for DvMF_3108 in Desulfovibrio vulgaris Miyazaki F

Annotation: Rhomboid family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 121 to 142 (22 residues), see Phobius details amino acids 190 to 202 (13 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details PF01694: Rhomboid" amino acids 169 to 306 (138 residues), 73.5 bits, see alignment E=9.9e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_3108)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJG8 at UniProt or InterPro

Protein Sequence (343 amino acids)

>DvMF_3108 Rhomboid family protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MASGLGARPEHVAAALRRRPVLPPGWRDLTVPVPPAQNAALPAPLPQLPSCTAQCLPRWR
LVLEARNIPFMAVRRGERQHFFVPALYERLARQELLAAEGEDAAARARPPAPPPAPLRAN
VHLTLLGLLLLALWHGVRMGWWWDMHLPLPDLDPDVWRDAGAMDVYYTVARGQWYRVVTA
LTLHADSPHLFGNILFGSFFLVPLCRRVGSGPGWLLTILAGAGGNVLNALARPASHVSLG
FSTALFGAVGVLSGLLAVEGGWSGWRRMVVPLAAGLAILGMLGSEGERTDLGAHLFGLVA
GVAVGMAAQGLREWLGPPPRWLEWLAGAACAALLAGCWMLALR