Protein Info for DvMF_3106 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF6 transmembrane (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 192 to 218 (27 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 308 to 325 (18 residues), see Phobius details PF00892: EamA" amino acids 5 to 133 (129 residues), 47 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_3106)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJG6 at UniProt or InterPro

Protein Sequence (326 amino acids)

>DvMF_3106 protein of unknown function DUF6 transmembrane (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSWTFPALLAAVLAALDATLLRRLAGDLPPARMVAYPVFWSLPPFLALLAARGVSDLPAP
FWLATLAAVPVNMAGHLLTAWAVRLAPVSRTVPYLCFSPVFVVVHEYLLLGVAPRPAGVA
GVLLVVAGSWVLNAGGAETHDPGHDEDGGSGIMTRLLRPFRTLMAEPGARIMLGVALLWG
LGSVLNRKMVLYATPAVAGGVFFAIYGPAMLAALMLFGGVRPRMLVDRPLRGAAMGAVLF
LAAYAHFTAMSLTTAANMIAVKRLDGVFAVLIDRLSEWLAGRAEGPRSVRRAGLPAAGAG
WRPVRDGRLPGAALMAAGAALVVLAS