Protein Info for DvMF_3007 in Desulfovibrio vulgaris Miyazaki F

Name: thiE
Annotation: thiamine-phosphate pyrophosphorylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 9 to 190 (182 residues), 219 bits, E=1.6e-69
• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 9 to 203 (195 residues), 212.3 bits, E=2.1e-67

Best Hits

Swiss-Prot: 62% identical to THIE_RHOFT: Thiamine-phosphate synthase (thiE) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to dvm:DvMF_3007)

MetaCyc: 39% identical to thiamine phosphate synthase (Bacillus subtilis subtilis 168)
Thiamine-phosphate diphosphorylase. [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• thiamine diphosphate salvage II (5/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate salvage V (3/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage IV (yeast) (4/7 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

See B8DJ67 at UniProt or InterPro

Protein Sequence (213 amino acids)

>DvMF_3007 thiamine-phosphate pyrophosphorylase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRRNADYGVYLVTDRTLCRGRALTDVVTAAVAGGVTVVQLREKHVDTREFVELARALKAL
LAPRGVPLLINDRVDVALACQADGVHVGQGDMHPADVRALLGHSALVGLSVETMDQVREA
ETLDVDYLGVSPVFATATKTDTAPPWGLDGLARLRAATGRTLVAIGGIGPANAASVLAAG
ADGLAVVSALCAADDPGRAAEELRGSVRAVRGW