Protein Info for DvMF_2899 in Desulfovibrio vulgaris Miyazaki F

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 58 to 82 (25 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details PF13160: DUF3995" amino acids 19 to 141 (123 residues), 78 bits, see alignment E=4.4e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2899)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DS81 at UniProt or InterPro

Protein Sequence (150 amino acids)

>DvMF_2899 hypothetical protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTILTLLSAVAAFVATVCLAAIALLHGAWVLGSTLWLDKVIPRTPDSVGGRPLFAVSRGL
TGAVTLAFAMLALLPGLTLGWLPLPPPGMAPTLCLGAAFIFVVRAIGDFRYCGVFRRIRS
TTFAHWDARLYTPLCLLLAACYGLLGVAPH