Protein Info for DvMF_2892 in Desulfovibrio vulgaris Miyazaki F

Annotation: adenylylsulfate reductase, beta subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02060: adenylylsulfate reductase, beta subunit
  • amino acids 1 to 132 (132 residues), 247.3 bits, E=1.4e-78
• PF12800: Fer4_4
  • amino acids 7 to 27 (21 residues), 10.4 bits, see alignment (E = 0.0002)
  • amino acids 44 to 60 (17 residues), 18.1 bits, see alignment (E = 6.5e-07)
• PF13187: Fer4_9
  • amino acids 9 to 62 (54 residues), 31.2 bits, E=4.6e-11
• PF12838: Fer4_7
  • amino acids 9 to 61 (53 residues), 30.6 bits, E=9.8e-11
• PF00037: Fer4
  • amino acids 44 to 63 (20 residues), 25.9 bits, see alignment (E = 1.6e-09)
• PF12139: APS-reductase_C
  • amino acids 65 to 136 (72 residues), 108.5 bits, E=3.9e-35

Best Hits

Swiss-Prot: 86% identical to APRB_DESGG: Adenylylsulfate reductase subunit beta (aprB) from Desulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)

KEGG orthology group: K00395, adenylylsulfate reductase, subunit B [EC: 1.8.99.2] (inferred from 100% identity to dvm:DvMF_2892)

MetaCyc: 68% identical to APS reductase beta subunit (Thiobacillus denitrificans)
Adenylyl-sulfate reductase. [EC: 1.8.99.2]

Predicted SEED Role

"Adenylylsulfate reductase beta-subunit (EC 1.8.99.2)" in subsystem Anaerobic respiratory reductases (EC 1.8.99.2)

MetaCyc Pathways

• dissimilatory sulfate reduction I (to hydrogen sufide)) (5/5 steps found)
• sulfite oxidation III (2/3 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (4/6 steps found)
• sulfite oxidation II (1/3 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (2/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)
• superpathway of sulfur oxidation (Acidianus ambivalens) (1/9 steps found)

KEGG Metabolic Maps

• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.2

Use Curated BLAST to search for 1.8.99.2

Sequence Analysis Tools

See B8DS74 at UniProt or InterPro

Protein Sequence (167 amino acids)

>DvMF_2892 adenylylsulfate reductase, beta subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPTYVDPSKCDGCKGGEKTACMYICPNDLMILDPEAMKAYNQEPEACWECYSCVKICPQG
AITARPYADFAPMGGTCIPMRSADSIMWTVKFRNGNVKRFKFPIRTTPEGSIKPFEGKPE
AGDLENELLFTETALIAPKVALGEKAAISDSDLSQCWYETGCEGGNR