Protein Info for DvMF_2771 in Desulfovibrio vulgaris Miyazaki F

Annotation: Lysine exporter protein (LYSE/YGGA) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details PF01810: LysE" amino acids 15 to 193 (179 residues), 102.8 bits, see alignment E=8.5e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2771)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJ48 at UniProt or InterPro

Protein Sequence (203 amino acids)

>DvMF_2771 Lysine exporter protein (LYSE/YGGA) (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLYNLVALFGLCMVGRMSPGPDMMLLVRHGAGGPTRAAYACVLGICLGLTFHVTWAVLGT
GLLQGSPRAFQAVQLAGAGYLAWVGWKALRARADGGGEGTAPPTLREGFRDGLFCNLLNP
KVTLFILSVFTQFVAPGTPTGERVAYGAVIVLEALVGWTIFVRFLDTAPMRRFYERHGLH
LVRLTGALLLLLAGWSVVSFLRG