Protein Info for DvMF_2752 in Desulfovibrio vulgaris Miyazaki F

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 156 to 173 (18 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 29 to 292 (264 residues), 148 bits, see alignment E=1.5e-47

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to dvm:DvMF_2752)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJ30 at UniProt or InterPro

Protein Sequence (330 amino acids)

>DvMF_2752 inner-membrane translocator (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTVSRTTSYAGIAVVVAVLPLLLDPYWTDVFVSIGLYSVLALSLNIILGQAGLFHMGHAA
FYAVGAYVTAIANTMWGVPVLWAMPFAGLAAALFAMVVARPIIHLRGDYLLIVTIGIVEI
VRIALINNVFGLTGGANGIFGISRPMLFGFKIAKPVHFYYLVWAYVACSILLFRRLENSR
FGRALNYIKEDDTAAEGSGVNIASYKLWAFVLGAFWAGMTGTIYAAKMTIISPESFSFWE
SVVLFAIVILGGGSNRGVLLGAFLLIGLPEFFREFASARMLAFGLAMVVMMIFRPQGMLP
PMPRFYKLPERIRCITGKGGDAAAQAGGGA