Protein Info for DvMF_2692 in Desulfovibrio vulgaris Miyazaki F

Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR01221: dTDP-4-dehydrorhamnose 3,5-epimerase" amino acids 3 to 180 (178 residues), 223.3 bits, see alignment E=9.3e-71 PF00908: dTDP_sugar_isom" amino acids 5 to 179 (175 residues), 230.5 bits, see alignment E=5e-73

Best Hits

Swiss-Prot: 51% identical to RMLC_SINFN: dTDP-4-dehydrorhamnose 3,5-epimerase (NGR_a03520) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 100% identity to dvm:DvMF_2692)

MetaCyc: 51% identical to dTDP-4-dehydrorhamnose 3,5-epimerase (Escherichia coli K-12 substr. MG1655)
dTDP-4-dehydrorhamnose 3,5-epimerase. [EC: 5.1.3.13]

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.13

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIX0 at UniProt or InterPro

Protein Sequence (196 amino acids)

>DvMF_2692 dTDP-4-dehydrorhamnose 3,5-epimerase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQIIETGIPGLLRLEPRVFRDERGFFLETYRRDLFAALGVPAGFVQDNHARSEQPGVLRG
LHFQLPPATQAKLVWVTRGSVFDVAVDLRVGSPAYGKWYGCELSERNFARLFVPRGFAHG
YMTLEPGSEFQYKVDAYYSPERDAGIAWDDPDLGITWPDIAPALPILSDKDRRLPRLRDL
QSPFTFEPAPPAKADA