Protein Info for DvMF_2691 in Desulfovibrio vulgaris Miyazaki F

Annotation: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 18 to 497 (480 residues), 502 bits, see alignment E=8.3e-155 PF12804: NTP_transf_3" amino acids 18 to 120 (103 residues), 32.6 bits, see alignment E=1.8e-11 PF00483: NTP_transferase" amino acids 18 to 314 (297 residues), 130.5 bits, see alignment E=1.6e-41 PF01050: MannoseP_isomer" amino acids 343 to 493 (151 residues), 201.5 bits, see alignment E=1.4e-63 PF07883: Cupin_2" amino acids 410 to 477 (68 residues), 33.1 bits, see alignment E=7.5e-12

Best Hits

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 100% identity to dvm:DvMF_2691)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.22 or 5.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIW9 at UniProt or InterPro

Protein Sequence (501 amino acids)

>DvMF_2691 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTISPANAAPTPLDRCHAVILAGGSGTRLWPLSRALFPKQLLALNGDLSLLQQTVRRVLS
LFPPERVHIVTNEEHVFEVRAQARALDERLDTQVLAEPVGRNTLPAILLGLDAAMNAATG
TAEADDAAQPPLLAVFPSDHQLHDEVRWGAAVTRGAGLAAEGWTVTFGVPPTTPETGYGY
IRRGELLSNANAAAQGAAFAVDGFVEKPDLETARGFLRQGMHFWNSGMFVFNGGVLLAAV
ERFQPTLATWWTTRTDASLAPGIPLTHGYSTLPSISIDYGIMEHVDRIAVVEAAFGWDDL
GSWEALYRLGAKDERGCVIQGDTMALDCDDCLLLSRGGKLVAIGLSNVIAVQTRDATLIC
AKDQVQRVKDVVEKLKAEKSPLVDVHLTVRRPWGNYTVLDEGPGRKVKRIEVNPGARLSL
QMHHHRSEHWVVAKGAALVQVGNEERTLTENEWVDIPKATLHRLTNPGRIPLELIEIQSG
PYLGEDDIVRFDDVYGRRKEG