Protein Info for DvMF_2679 in Desulfovibrio vulgaris Miyazaki F

Annotation: two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF00072: Response_reg" amino acids 3 to 114 (112 residues), 89.2 bits, see alignment E=6.1e-29 PF00158: Sigma54_activat" amino acids 167 to 333 (167 residues), 199.1 bits, see alignment E=1.3e-62 PF14532: Sigma54_activ_2" amino acids 185 to 338 (154 residues), 53.9 bits, see alignment E=7.6e-18 PF07728: AAA_5" amino acids 189 to 308 (120 residues), 22.9 bits, see alignment E=2.3e-08 PF25601: AAA_lid_14" amino acids 339 to 409 (71 residues), 79.3 bits, see alignment E=4.8e-26 PF02954: HTH_8" amino acids 456 to 486 (31 residues), 32.9 bits, see alignment (E = 1.3e-11)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2679)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIV7 at UniProt or InterPro

Protein Sequence (486 amino acids)

>DvMF_2679 two component, sigma54 specific, transcriptional regulator, Fis family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRILIVDDNLPSLQSLSLVLHDLGYEPTPFEDPVAALAEARTTWFPLIITDIRMPGMDGL
TLLSHLKEDPSTAEADVVLITGHGDMETAVEALRRGAYDYLNKPINARELAAVVERCAEH
QALLMENRELREHLDEVVEERADTLRRELESARTRLRQVTGIGEVVAASPAMSGLLDETR
VFHAEPSVPVLIEGETGTGKEVVARLIHYGESGNDTPFIALNCAAIPHELFEAELFGHEP
GAYTGSRAGGSPGKLELAGGGTLFLDEVAEMPLSLQPKLLRVLEERCFYRLGGVKRREFK
ARVVCAGNRDLSAMVEAGQFRRDLYHRLRVGHLRIPPLRERPEDIPVLAELFLQREAVRK
KKRFTALSPDALRLLGRHPWTGNVRELENAVERAVLLHDGPALTARHLSFLDEHGVAEVP
GPAVAGQPGTWRLDPDNLTLPDAPFDVEALVDGLVRKAVERFGGNKSRAAAHLGISRFAL
HRRLAK