Protein Info for DvMF_2667 in Desulfovibrio vulgaris Miyazaki F

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 102 to 140 (39 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2667)

Predicted SEED Role

"Predicted cobalt transporter in sulfate-reducing delta-proteobacteria" in subsystem Coenzyme B12 biosynthesis or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIU5 at UniProt or InterPro

Protein Sequence (323 amino acids)

>DvMF_2667 hypothetical protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTDAQTTWHLWDGLGRPLLRLVLSMSVGLFVANCIEALNWTRGVARLATPLVRLGHLRDV
AGASFSLAFFSSVASNSLLAESYEKGELSRRELRFANLFNSLPSYFVHLPTLFFITWPVL
GFPAVIYVGLTLLAAFLRTALTVACGRVLLPPLPEGCVTCRLDGRESKGWRAGLRTAWVR
FRKRMPRVVFFTVPTYAAMYFMQQAGWFALAEAWMTRHMGALSFLRPEALGIVLLHLAAE
FGAAVSAAGAVLGGGGLSEREIVLALLAGNVLSTPMRAFRHQFPSYAGYFKPALAAELIV
VNQALRAASITLVGAGYYWLTIP