Protein Info for DvMF_2649 in Desulfovibrio vulgaris Miyazaki F

Annotation: heat shock protein Hsp20 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF00011: HSP20" amino acids 50 to 87 (38 residues), 21.2 bits, see alignment 1.3e-08 amino acids 131 to 182 (52 residues), 31.1 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2649)

Predicted SEED Role

"heat shock protein, Hsp20 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIS7 at UniProt or InterPro

Protein Sequence (185 amino acids)

>DvMF_2649 heat shock protein Hsp20 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTPPDRRPRFPHPASRPARQNERGGAESRARQGRFAQSPQPPRMRPQADLVEREDGFHLF
LDMPGVAHDDLVLDVEGDELTVRGVTRFGDCRDMGRDAARDGGRDGDAESDTTDNPAHPP
CGCGPAGGPRVHAMEFGDVEYHAVFTLSDMVDATRISAQLANGVLTIRMPKREAAAPRRI
TVEHL