Protein Info for DvMF_2637 in Desulfovibrio vulgaris Miyazaki F

Annotation: diguanylate cyclase with extracellular sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 282 to 302 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 52 to 270 (219 residues), 65.9 bits, see alignment E=3.3e-22 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 313 to 473 (161 residues), 161.7 bits, see alignment E=6.3e-52 PF00990: GGDEF" amino acids 318 to 470 (153 residues), 150.2 bits, see alignment E=4.4e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2637)

Predicted SEED Role

"diguanylate cyclase with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIR5 at UniProt or InterPro

Protein Sequence (474 amino acids)

>DvMF_2637 diguanylate cyclase with extracellular sensor (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MFSRLSLVLFRILPLAVLLAGAFPGICRADSGPADVRFTPAEQRFIRETGPITLCVDPDW
PPFERVEVHNGQPRHVGIAADIIALVAQRTGLTFELVPTASWDESIAAAREGRCQVLSFL
NQTPQREAWLGFTDPLLTDPNVFITRTEHPAIIDPAALEGATIVFPRGTAMEELVRKDYP
NLKVLVTESEAEAIRMVEERKADMTMRSLIVAAYTIRQQGLFNLKIAGKLPEYENKLRMG
VVRHDPLLRTVLNRGIRSLTLEERQQIVNRHVPITAQTSADYWLVARVAGFFALLVGVVL
WYNRRLKRMNAVLERLARTDPLTDLPNRSRLNELFRREVERAQRYRRPFSIVILDIDHFK
RVNDELGHLAGDRTLQVFAGVVRDSVRGTDTVGRWGGEEFLVLCPETTAEEAVQLAERLR
GSLRATQFEGGRIHTLSAGVAAFREGDSVDTLLHRADTALYRAKNGGRDRVEVE