Protein Info for DvMF_2621 in Desulfovibrio vulgaris Miyazaki F

Annotation: Nitrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 PF00148: Oxidored_nitro" amino acids 84 to 306 (223 residues), 224.4 bits, see alignment E=1.2e-70 amino acids 330 to 523 (194 residues), 180.9 bits, see alignment E=1.8e-57

Best Hits

KEGG orthology group: K02592, nitrogenase molybdenum-iron protein NifN (inferred from 100% identity to dvm:DvMF_2621)

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifN" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR82 at UniProt or InterPro

Protein Sequence (538 amino acids)

>DvMF_2621 Nitrogenase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTLDFVELDGPCAGGDAGSCDRGGDCGKSCAESGPHDCADDCGLAPLAPVALKAAPSTGG
GKPGKTPRPKRPDFVSTTNACKLCTPLGAMLAFRGVEGAVPFLHGSQGCATYMRRYVISH
YREPMDIASSSLGEKQAVYGGGPNLKKGILNVMKKYDPVLVGVATTCLTETIGDDVGGYL
REFRNEFGDLDLPEIVHVHTPSYNGTHLEGWHAAVRALVDQLARDRVEPHGKVALLPGFV
SPADLRHLRDLITDFGSDAVILPDLSDPLDGPALEDYTPLPEGGTPLADIRALSGAAGVI
ECGRSLAMTPTGSSGSSGSSGSSGSAGPATAGRVLDERFGLPLHAVGLPIGLRETDALVS
ALEAITGKPLPHKHELERGRFVDALVDGHKYVSGKRAVVYGEADLVIGLVSLLTEIGVHT
VLAATGMRGAHLAESIAAVTEGMLPAMPTVIEGADFEEIADTAEGLSPDLLVGNSKGYRY
ARQWNIPLVRAGFPIHDRFGGHRLLHVGYAGAQALMDRIVNAVIEKTQSDSPVGYCYL