Protein Info for DvMF_2609 in Desulfovibrio vulgaris Miyazaki F

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 330 to 356 (27 residues), see Phobius details amino acids 368 to 385 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 113 to 379 (267 residues), 170.1 bits, see alignment E=2.8e-54

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to dvm:DvMF_2609)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR70 at UniProt or InterPro

Protein Sequence (415 amino acids)

>DvMF_2609 inner-membrane translocator (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQGLKKSILVSLWFMFLTFPLMVIRIDSLNGTIDWRWENMLGMGVGSFVLSFVWRFMLAR
KEAGRAAAAGGAMSARGAWFERLRSDPKAAVPALVVLLSAFLVLPWVVSTYQTNIMISAL
LYVMLGLGLNIVVGLSGQLVLGYVAFYAVGAYSYAILNSNFGLGFWSVLPIGGAMAALFG
ILLGFPVLRLRGDYLAIVTLGFGEIIRLVLENWSSFSQGPSGIANIERPGLLGMQLSVSD
ATTYIYYLILAAVIVTILAVTRLKNSRIGRAWQALREDEIACQAMGIDITTTKLTAFALG
ACWAGFAGVIFAAKTTFINPASFTFLESAMVLAMVVLGGMGSVIGVSVGALVLILLPEYL
RAFSEYRMLIFGATMVLMMVFRPQGLVSPGRTKYNVPDAQGAGADAARPAAGGNA