Protein Info for DvMF_2598 in Desulfovibrio vulgaris Miyazaki F

Annotation: cytochrome c class III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02085: Cytochrom_CIII" amino acids 59 to 143 (85 residues), 33.3 bits, see alignment E=1.3e-11 amino acids 159 to 253 (95 residues), 31.8 bits, see alignment E=3.7e-11 amino acids 288 to 393 (106 residues), 60.2 bits, see alignment E=5.2e-20 amino acids 480 to 551 (72 residues), 39.1 bits, see alignment E=2e-13 PF22113: Mtrc-MtrF_II-IV_dom" amino acids 113 to 260 (148 residues), 31.9 bits, see alignment E=2.4e-11

Best Hits

Swiss-Prot: 68% identical to HMWC_DESVH: High-molecular-weight cytochrome c (hmcA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2598)

MetaCyc: 68% identical to Hmc complex A subunit (Desulfovibrio vulgaris)

Predicted SEED Role

"High-molecular-weight cytochrome c precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR59 at UniProt or InterPro

Protein Sequence (556 amino acids)

>DvMF_2598 cytochrome c class III (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MMNAKSLLRWAGALVAVAAVTVFGLDARGTTKPLPGSTGEQRADLVEIGVMAKFGNLELP
KVTFPHDRHSEAVAKVAAPGKECATCHKNDDKGKMSLKFMRLEDTTAADLKNIYHANCIG
CHTEQAKAGKKTGPQDGECRSCHNPKPMASSWKQIGLDKSLHFRHVAAKAIAPVNDPQKN
CGACHHVYDEAAKKLSWVKNKEDSCRACHGDARVEKKPSLREAAHTQCITCHRSVAAAPA
KADSGPVSCAGCHDPAMQAKFKVVRDVPRLERGQPDAAMVLPVVGPGAKDTPKGMKGAMK
PVAFNHKVHEAASNTCRACHHVKIDNCTTCHTLEGVKDGNFVQIEKAMHQPDSMKSCVGC
HNQKVQAPACAGCHGFMKTGAKPQPEAACGVCHADPVGMDAKTVADGGLLKATKEQRADV
AAATLAARRTTKGTLPADDIPEFVTIGVLSDKYEPSKLPHRKIVNTLMAAIGDDKLAGTF
HTDKATVCAGCHHNSPASKTPPKCASCHGQPFDAAKGDRPGLKAAYHQQCMGCHNRMKLE
KPADTACAECHKERAK