Protein Info for DvMF_2597 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 262 to 285 (24 residues), see Phobius details PF12838: Fer4_7" amino acids 50 to 128 (79 residues), 28.6 bits, see alignment E=5.5e-10 PF13247: Fer4_11" amino acids 107 to 203 (97 residues), 73.9 bits, see alignment E=3.7e-24 PF13237: Fer4_10" amino acids 137 to 194 (58 residues), 26.5 bits, see alignment E=1.8e-09 PF12837: Fer4_6" amino acids 137 to 159 (23 residues), 26.2 bits, see alignment (E = 1.9e-09) PF00037: Fer4" amino acids 138 to 158 (21 residues), 23.6 bits, see alignment (E = 1.2e-08)

Best Hits

Swiss-Prot: 76% identical to HMC2_DESVH: Protein DVU_0535 (DVU_0535) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2597)

MetaCyc: 76% identical to Hmc complex B subunit (Desulfovibrio vulgaris)

Predicted SEED Role

"Iron-sulfur protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR58 at UniProt or InterPro

Protein Sequence (372 amino acids)

>DvMF_2597 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MNRRRFLTLLGTAGVSTAMSAVGAKKAVAAGNQSFKGYKDSYGVLHDTTRCIGCRKCEQG
CNEVNKLPAPKVKFDDLTVLEKSRRTDSNNWTVVNKYNVAGLDHPVFRKQQCNHCLEPAC
ASACFVKAFTKNPDGSVTYDGSLCVGCRYCMIACPFNVPAFQYDEPFDPLIQKCTMCHPR
IQEGKLPGCVEACPKEALTFGKREDLVRIAHDRIRSNPGRYQDHVYGELEMGGTAWMYLA
GVPFEAVGQQEMGTKSAPEYTAGALGSVPMVVGIWPVLLTGAYAISKRKEKVAAEEREEA
VQAALAKARDDAAKAMDTALAKAAKEKDAAVTREVKKAMEQAEQAFEEKFAALRAEGQTA
ENGDDGEGKEDA