Protein Info for DvMF_2577 in Desulfovibrio vulgaris Miyazaki F

Annotation: potassium-transporting ATPase subunit A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 420 to 445 (26 residues), see Phobius details amino acids 464 to 487 (24 residues), see Phobius details amino acids 534 to 556 (23 residues), see Phobius details amino acids 572 to 594 (23 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 2 to 605 (604 residues), 693 bits, see alignment E=1.5e-212 PF03814: KdpA" amino acids 11 to 604 (594 residues), 752.5 bits, see alignment E=1.1e-230

Best Hits

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to dvm:DvMF_2577)

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR38 at UniProt or InterPro

Protein Sequence (612 amino acids)

>DvMF_2577 potassium-transporting ATPase subunit A (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTPRDYLQLALFLGILAAASPPLGRYIHRVLEGGRTWLHPLLGPVERLIYTAAGIDPASD
QPWQRYAASLLGFTLAGFCLTFGVLLFQDVLPLNPQHFPAPSWDLALNTAVSFVTNTNWQ
AYGGETAMSHLSQVVALTYQNFVSAAVGMAACMAVVRGIARTEAQGIGNFWADLVRSTLY
VLLPLCVPGALLLVGQGMVQTLAASFTATTPEGAVQTIAVGPVASQVIIKMLGTNGGGFF
NANAAHPFENPTAVANFIQMLAIFLLPSSLVFTLGAAVRRPRHAWTVWGVMAAVFVAGTL
LTAHFEYRGTPAMAQAVAPGSPAASGSSTSAASAGASIAASGVTPHPASAPASAPVPVSV
AVSASVPNMEGKEVRFGIFSSSLFATVTTDASCGAVNAMHDSLTPLGGLVTLLNMQLGEI
IFGGVGSGLYGMVLFIILTVFLAGLMVGRTPDYLGKRIEGREVTLAVAALLLPALPLLGF
TALAAVGWGPQALANAGAHGFSELLYAYTSSAQNNGSAFAGLAANSPVFNLTTAASMLIG
RFGVMLPMLAVAGSLAARRPRPVTDASFPVEGATFALLLASVILIVGALTYLPALSLGPI
VEHLQMIENQLY