Protein Info for DvMF_2567 in Desulfovibrio vulgaris Miyazaki F

Annotation: phosphate ABC transporter, inner membrane subunit PstA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 171 to 196 (26 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 287 to 319 (33 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details PF11812: DUF3333" amino acids 11 to 71 (61 residues), 51.3 bits, see alignment E=1.5e-17 amino acids 80 to 127 (48 residues), 32.3 bits, see alignment 1.1e-11 TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 148 to 386 (239 residues), 231.1 bits, see alignment E=6.7e-73 PF00528: BPD_transp_1" amino acids 186 to 376 (191 residues), 78.7 bits, see alignment E=4.7e-26

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to dvm:DvMF_2567)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR28 at UniProt or InterPro

Protein Sequence (389 amino acids)

>DvMF_2567 phosphate ABC transporter, inner membrane subunit PstA (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MASLFGIDEKKLLRKRRAAETRFRLCAIFALFLAGAFLVFFLFDIGRKGYPAFQQAELLV
SVNYTVEAHDNPYAAMDPDTVQVVSRSFTRLIPSMMAENSRLIGTTQEVWVLASADTDQY
LKGRPNRLKPRHQALVDTMRQEGKARLAFNWGFFESGDSKLPELAGIRAAAIGSLYVLLI
TLAISFPVGVMCAVYLEEFAPDNRLTQIIEVNINNLAAIPSILYGLLGLAIFINFMGVAR
SSALVGGLTLSLMTLPAIIISTRAAIRSIPPSIREAALALGATPLQVVWHHVLPLSLPGI
LTGTIIGLARAMGETAPLLIVGMMAYIPEAPENFNSAATVLPAQIFTWASDSQRAFSERT
AAGILVLLVLLLGMNATAIWLRNKYERKW