Protein Info for DvMF_2560 in Desulfovibrio vulgaris Miyazaki F

Annotation: transcriptional regulator, AraC family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 16 to 22 (7 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 8 to 190 (183 residues), 79.1 bits, see alignment E=5.4e-26 PF00165: HTH_AraC" amino acids 242 to 278 (37 residues), 32.9 bits, see alignment 8.3e-12 amino acids 293 to 328 (36 residues), 30.5 bits, see alignment 4.5e-11 PF12833: HTH_18" amino acids 251 to 329 (79 residues), 84.8 bits, see alignment E=6.2e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2560)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR21 at UniProt or InterPro

Protein Sequence (333 amino acids)

>DvMF_2560 transcriptional regulator, AraC family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPQSARHIVFALYPGFVGLDLAGPLDVFSCAARLAGRQGRPAPYRCHFVARALGPVVSSS
GMSVLAETTPDAFDATVAGPDAPAPHTLVVPGGVTPGREGDDPELRAMVAGLAARARRVV
SVCTGALLLAACGLLDGRRATTHWQACARLAAAYPAVRVEPDAIFVRDGGVVTSAGVTAG
IDLALHLVEEDLGPATAMEVARLLVVYRRRVGNQSQFSAPLRAQARAGARFGPLHVWMEA
RLGEDLGVERLAGQAHMSPRHFARVFPQETGMSPARYVEQLRLDRARELLESGESHMQTV
AVAAGFGSEERLRRAFQRRMGVTPSQYLEHFSG