Protein Info for DvMF_2550 in Desulfovibrio vulgaris Miyazaki F

Annotation: multi-sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 685 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 105.5 bits, see alignment E=5.5e-34 PF08448: PAS_4" amino acids 178 to 284 (107 residues), 42.7 bits, see alignment E=1.8e-14 amino acids 300 to 406 (107 residues), 50.7 bits, see alignment E=5.7e-17 PF13426: PAS_9" amino acids 186 to 281 (96 residues), 22.9 bits, see alignment E=2.5e-08 amino acids 307 to 403 (97 residues), 26.9 bits, see alignment E=1.4e-09 TIGR00229: PAS domain S-box protein" amino acids 293 to 411 (119 residues), 31.8 bits, see alignment E=6.9e-12 PF02518: HATPase_c" amino acids 555 to 665 (111 residues), 82.2 bits, see alignment E=1.2e-26 PF14501: HATPase_c_5" amino acids 558 to 652 (95 residues), 29.6 bits, see alignment E=1.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2550)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR11 at UniProt or InterPro

Protein Sequence (685 amino acids)

>DvMF_2550 multi-sensor signal transduction histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MGASILLVDDEEGIRTVLGISLADAGYDVTTAASGEEALARFAAHRPDIVLTDIKMPGLS
GLDLLERLKAADPEVEVIMLTGHGDMDLAIQSLKRDATDFLTKPVNDDMLEVALRRAEER
ISMRQRLRGYTENLEQMVRDQSARLVEAERQLAALQVMDGIASGIRSLCSALDDGGLFNE
LPCFVAVHNADLEIVSTNQLYKERLGHRIGSRSWEAYAGRGPGDRLCPVMRVLETGEGFR
SNEVLLGRNGQEIPVIVNTAPIYGNDGEVELVLELSVDVSEVRRLREDLRLTRERFRQLF
DESPCYVAVMDRDFGVVEANRRYREDFGDPTGRRCHDAFAHRLAPCSGCPAGRTFDDGRP
HQAETVVTARDGRQVNVLVWTAPLRDAEGAITEVMEMSTDITELRRLQDRLSQLGLLLGS
TAHGIKGLLTALDGGVYRLGSGIARGDAARVQDSHQDIRHLVDRLRKMVLDLLYYAKNRE
LNWEVVVTRAFAEETAMLVEAKATERGVRFVRDFAGTRAEESAETATDAGETTGTAQTGS
AASGGTADLGTFEADTGALSSALVNLLENAVEACAADGRKQDHAVTFRVRGAPEEVTFTI
IDNGTGMDRETREKLFTLFFSSKGTAGTGIGLFVASQVVRQHGGHIAVASEPGEGSTFTV
SLPRRLPEAVRRGDGAEEERTENGG