Protein Info for DvMF_2517 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF1078 domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR03506: flagellar hook-basal body protein" amino acids 5 to 138 (134 residues), 137 bits, see alignment E=1.3e-43 amino acids 149 to 236 (88 residues), 76.3 bits, see alignment E=3.7e-25 TIGR02490: flagellar basal-body rod protein FlgF" amino acids 7 to 235 (229 residues), 201.4 bits, see alignment E=1.4e-63 PF00460: Flg_bb_rod" amino acids 17 to 35 (19 residues), 26.2 bits, see alignment (E = 9.6e-10) PF22692: LlgE_F_G_D1" amino acids 99 to 163 (65 residues), 55.5 bits, see alignment E=7.5e-19 PF06429: Flg_bbr_C" amino acids 209 to 253 (45 residues), 68.6 bits, see alignment 4e-23

Best Hits

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 100% identity to dvm:DvMF_2517)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN16 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DvMF_2517 protein of unknown function DUF1078 domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQEGMLSSLFGALTNEHRMNNISNNLANVNTTGYKRDVISFKDTMQLFAHDQIMEPIANV
RSKKLFPEPMHVARPRIAVAHTDFEQGSMRYTGNPLDVAISGNAFFKVRTPEGEFYTRNG
NFIQTADGQLVTAMGHAVQGDGGDIALPPGEAVQISDDGQIFAGGALVGQLNMVTVNDLT
ALEKLGGNMYRLRPGSNAGEVPAERAYVAQGYLEASNVEVVSEMVNMIEAQRQFEAYQKV
MQTTDSIDREATQKVGKKV