Protein Info for DvMF_2486 in Desulfovibrio vulgaris Miyazaki F

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 127 to 153 (27 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 304 (197 residues), 56.3 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to dvm:DvMF_2486)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMY6 at UniProt or InterPro

Protein Sequence (318 amino acids)

>DvMF_2486 binding-protein-dependent transport systems inner membrane component (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTEGPISPEPRHLPDRRIPSGARPRTREHALTVAAWLAALLVAAVAAVGCGYLLWRGVPT
LGRALFFGDAPPLLAMAGLRPVWDGIWPACAGSLYLVGLATLLVLGPGVGCGIYLAEYAG
PRARRHLGLAVELLAGVPSIVMGLFGFTLILVLRRTFVPQANTCLLLAAGCLALLVLPPL
VVSTRAALESLPHGLRLTGAALGLTREQTVFRVLLPEAGRGILGGVMLAMGRAAEDTAVI
LLTGVVANAGLPAGLLAKFEALPFTIYYTAAQYQTEDELARGFGAALVLLVLSGSMMLGA
GALQRVMARRHKGEDAWN