Protein Info for DvMF_2476 in Desulfovibrio vulgaris Miyazaki F

Annotation: TOBE domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF00589: Phage_integrase" amino acids 159 to 293 (135 residues), 38.2 bits, see alignment E=1.3e-13 TIGR00638: molybdenum-pterin binding domain" amino acids 312 to 380 (69 residues), 60.1 bits, see alignment E=8e-21 amino acids 384 to 450 (67 residues), 57.3 bits, see alignment E=6.1e-20 PF03459: TOBE" amino acids 314 to 377 (64 residues), 51.8 bits, see alignment E=7.6e-18 amino acids 386 to 449 (64 residues), 42.8 bits, see alignment E=4.9e-15

Best Hits

KEGG orthology group: K02019, molybdate transport system regulatory protein (inferred from 100% identity to dvm:DvMF_2476)

Predicted SEED Role

"molybdenum-pterin binding domain protein/site-specific recombinase, phage integrase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMX6 at UniProt or InterPro

Protein Sequence (452 amino acids)

>DvMF_2476 TOBE domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHAPLAGIVGALDETQLELMRACIERELEARLGGGVSGLPVEPGAAPPDSPHDSAVDNAG
ADCLGAATLHSIVTALSGVPGMGGGGACPRGALRDGDDTAPRPAPKATDVPCPAQSFEVP
EGVKHLTSEQLDELTATFLAWFGAASTPVQRRSRGRLWVAFLMMRHGALRLGEVLALDDA
ADLDPVRQQVIVRGHGGREIQLPGPVMREVQRVLDDPMMFGLRGRVFRMDQGYVRRKFYE
RAAECSIPKEYLNPRVIRHSRAVELLRGGVPLKIVQGILGHQSMNQTASYLRFSDDDVRR
IVHHYLNKETRMRTSARNAFTGRVTSVVRDGLLVEVELTTNSGLKVVSVITEESAQNLGV
STGRVMTATVKAPWVILAREENRLKTSARNRYAGKVARVNLSEIAAEVVVDLPEGTTVCA
LLTVESVKTLDLAPGTDILVMFKAFSVILNVE