Protein Info for DvMF_2453 in Desulfovibrio vulgaris Miyazaki F

Annotation: integral membrane protein MviN (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 64 to 82 (19 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details amino acids 429 to 451 (23 residues), see Phobius details amino acids 462 to 482 (21 residues), see Phobius details amino acids 488 to 509 (22 residues), see Phobius details amino acids 522 to 542 (21 residues), see Phobius details amino acids 557 to 578 (22 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 39 to 338 (300 residues), 250.2 bits, see alignment E=2e-78 PF03023: MurJ" amino acids 66 to 339 (274 residues), 219.4 bits, see alignment E=7.7e-69 amino acids 380 to 514 (135 residues), 97.1 bits, see alignment E=9.6e-32

Best Hits

KEGG orthology group: K03980, virulence factor (inferred from 100% identity to dvm:DvMF_2453)

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMV4 at UniProt or InterPro

Protein Sequence (596 amino acids)

>DvMF_2453 integral membrane protein MviN (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTPPTAQAAPASTHSANADPDGMPPDRSAPGNTSPDSTSMARNAATVAGATLVSRVLGYA
RDALTAHILGAGAGADAFFVAFRLPNLMRRLLGEGAVSLAFTPAYVRLREGEGNARAFAF
GRGVVLRALLPLALLCLAGMALAHPLALLLAPGFGAQDAPPGVTDRAAHLLRICLPYGVA
ATCAALCAGMLHAHGRFLPPALAPAVLNLVVMATGGLALAGFGDAATLLACGVLAGGVAQ
LGLQLTALHPLGLRWRAPLPRSDPQAGEAARALPAGVFGASAQQLNVLACTLLASFLSEG
SVTALYYAERLMEFPLGVFGVAVGVAALPALSAQAGQADPFARAHRSAPCGPSSLSGASG
PSGPSGLSGLSGPCDTTHPHDGFRQVLSDALRLSLFISLPSALGLAAVAVPLVALLFGHG
AFDHQAVDATVAALLAYAPGIPAFAVTRPLLAACNARQATGAPVAAGLVSVVVTLALGAL
LLKPLGVAGPALAASCAAWVNTACLILALRRGGIPVDTYPRSALLHAALACAACLPAWWL
AGAGAGTAWAAPALHPAVRLALGVPLAAVLYLALSLCCHSRDARALLRVVRRKKTG