Protein Info for DvMF_2445 in Desulfovibrio vulgaris Miyazaki F

Annotation: HPP family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details PF04982: HPP" amino acids 61 to 198 (138 residues), 142.5 bits, see alignment E=3.7e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2445)

Predicted SEED Role

"membrane protein, HPP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMU6 at UniProt or InterPro

Protein Sequence (202 amino acids)

>DvMF_2445 HPP family protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDYFRKMCGCGRDNCRPGLLGLLPKPDVSETLWSFIGALCGIGVVAWLCDRVASPGDGFV
LIGSFGASAVLAYGAPGAPFSQPRNLLGGHVLSALVGVFVARNLGVPGLAGMSGAEAQVL
STAWLAPAVAVAAAIALMHLTDTLHPPGGATALIAVTGSPQIQALGYKYAVVPVAAGAAA
LLVVALLVNNIPRGRRYPRHWW