Protein Info for DvMF_2412 in Desulfovibrio vulgaris Miyazaki F

Annotation: type III secretion protein, YscU/HrpY family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 71 to 111 (41 residues), see Phobius details amino acids 140 to 152 (13 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 187 to 204 (18 residues), see Phobius details TIGR01404: type III secretion protein, YscU/HrpY family" amino acids 2 to 342 (341 residues), 371.2 bits, see alignment E=2.8e-115 PF01312: Bac_export_2" amino acids 3 to 340 (338 residues), 385.8 bits, see alignment E=9.6e-120

Best Hits

KEGG orthology group: K03229, type III secretion protein SctU (inferred from 100% identity to dvm:DvMF_2412)

Predicted SEED Role

"Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMR3 at UniProt or InterPro

Protein Sequence (346 amino acids)

>DvMF_2412 type III secretion protein, YscU/HrpY family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSDKTEQPTPKRLREAREKGDICKSQDVGSALTVLAVGAYLAIKGGDIFAEIMAVTELSM
RQMSLPFDQALPLLATAVTRGAIGIVLPVVGLAMCVGLLANLAQTGVLFALKAAMPKLEN
MSPGKWFKKVFSVRNAVEMLKNCIKVAVLGWAVWKVLSDHMRGLFAIPDGGIGGLLTVLG
ITARDMVLTSAAVFCVIAALDYMYQRWQYNKQHMMTKDEVKREYKEMEGDPHIKGKRKQL
HQEMITQNTLSNVRKAKVIVTNPTHYAVALDYEKDRTPLPVILAKGEGLLAKRMVEIARE
EGIPVMQNVPLARSLFAEGTENAYIPKDLIGPVAEVLRWVQSLQGR