Protein Info for DvMF_2330 in Desulfovibrio vulgaris Miyazaki F

Annotation: PP-loop domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF01171: ATP_bind_3" amino acids 50 to 169 (120 residues), 43.7 bits, see alignment E=1.4e-15 TIGR00269: TIGR00269 family protein" amino acids 192 to 293 (102 residues), 65.6 bits, see alignment E=2.2e-22

Best Hits

Swiss-Prot: 44% identical to TTUA_THET2: tRNA-5-methyluridine(54) 2-sulfurtransferase (ttuA) from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2330)

MetaCyc: 44% identical to tRNA-5-methyluridine54 2-sulfurtransferase (Thermus thermophilus)
RXN-18457 [EC: 2.8.1.15]

Predicted SEED Role

"tRNA(U54)-2-thioribothymidine synthetase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIH3 at UniProt or InterPro

Protein Sequence (311 amino acids)

>DvMF_2330 PP-loop domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKCKRCKETAVVALPSHHTGFCAECFLLFFTRQVERGIKERKLFTHDDRILVALSGGKDS
LSLMLELSRLGYDVTGLHIDLAIPGSSPAARGVVERFCEKHGLNLIVKEMGAEGLAIPDV
KARLNRPVCSACGKIKRYFFNKTALDENFTVLATGHNLDDEIARLFSNTLRWDVAYLSDQ
GPDLAADGGFARKVKPLWRLSEFETANYAFLMGIEHHYAPCPYSGGASFTFYKKLLTDLE
EEMPGRKLDFYQGFLERGRPVFARADNEDGVDLSGCTRCGYPTSNEVCGVCRIRDALRDK
VDTADGAEQAE