Protein Info for DvMF_2305 in Desulfovibrio vulgaris Miyazaki F

Name: hisH
Updated annotation (from data): IGP synthase, amidotransferase subunit (EC 4.3.2.10)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01855.
Original annotation: imidazole glycerol phosphate synthase subunit HisH (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  • amino acids 3 to 203 (201 residues), 189.6 bits, E=2.7e-60
• PF00117: GATase
  • amino acids 4 to 203 (200 residues), 74.6 bits, E=4.4e-25

Best Hits

Swiss-Prot: 100% identical to HIS5_DESVM: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 100% identity to dvm:DvMF_2305)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 4.3.2.10

Sequence Analysis Tools

See B8DQX7 at UniProt or InterPro

Protein Sequence (212 amino acids)

>DvMF_2305 IGP synthase, amidotransferase subunit (EC 4.3.2.10) (Desulfovibrio vulgaris Miyazaki F)
MLAILDYKAGNQTSVRRALDHLGIPCVITADPAVIAGAHGVIFPGVGAAGQAMNELLTTG
LDKVLKDQVQAGKPLLGICVGCQIMLDYSQENDTKALGIVPGECRLFNAAWTEEDGTPIR
VPHMGWNSIVQKRPCELLKGIEPEAEFYFVHSYYPAPPESYVIATCTYGEEFCAIHGGPG
LWAVQFHPEKSGRPGLALLRNFYAYCKEASRA