Protein Info for DvMF_2301 in Desulfovibrio vulgaris Miyazaki F

Annotation: molybdenum cofactor biosynthesis protein C (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 9 to 157 (149 residues), 182.7 bits, E=1.7e-58
• PF01967: MoaC
  • amino acids 20 to 155 (136 residues), 182.7 bits, E=1.6e-58

Best Hits

Swiss-Prot: 89% identical to MOAC_DESVH: Cyclic pyranopterin monophosphate synthase (moaC) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 100% identity to dvm:DvMF_2301)

MetaCyc: 49% identical to MoaC monomer (Thermus thermophilus HB8)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (2/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

See B8DQX3 at UniProt or InterPro

Protein Sequence (163 amino acids)

>DvMF_2301 molybdenum cofactor biosynthesis protein C (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MADDAEAAFSHMTEDGSVTMVDVGAKAPTQRTAIVRAVVEVNENTLDLLKRRALPKGDVL
TTAKIAGIMAAKRTAELIPMCHPLAISYADVRFVVQDAPPSIELEAEVRTTGQTGVEMEA
MVAAQVAGLTIYDMCKAVQKDIVLRDCRLVFKSGGKSGTFRAG