Protein Info for DvMF_2260 in Desulfovibrio vulgaris Miyazaki F

Annotation: cobalamin synthesis protein P47K (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF02492: cobW" amino acids 4 to 161 (158 residues), 42.6 bits, see alignment E=2.6e-15

Best Hits

Swiss-Prot: 43% identical to Y120_METJA: Uncharacterized protein MJ0120 (MJ0120) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2260)

Predicted SEED Role

"Ni2+-binding GTPase involved in regulation of expression and maturation of hydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQT4 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DvMF_2260 cobalamin synthesis protein P47K (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRLVTVAGPPSCGKTAVLSRACGLLAAQGVRTAVIKFDCLQTRDADAYVAAGITAVAALS
GGLCPDHFFATNLEEAWDWAAGTGAECCVIETAGLCNRCSPHLRGALALCVVDNLMGIDA
PEKIGPMLRLADMVLVTKGDLVSQAEREVYRHRIRQMNGRALIRHINGLTGQGCQELATV
LSRAPDIATVTDMRLRFAMPAAVCSYCLSETRIGARYQKGNVRKAEFAAVPARDPEGEAA
YAAGGPEEPREPGISGERP