Protein Info for DvMF_2249 in Desulfovibrio vulgaris Miyazaki F

Annotation: signal transduction histidine kinase, nitrogen specific, NtrB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details PF00672: HAMP" amino acids 181 to 222 (42 residues), 21 bits, see alignment 1.4e-07 TIGR00229: PAS domain S-box protein" amino acids 255 to 383 (129 residues), 47.8 bits, see alignment E=7.8e-17 amino acids 387 to 504 (118 residues), 28.9 bits, see alignment E=5.5e-11 PF13426: PAS_9" amino acids 280 to 374 (95 residues), 18.4 bits, see alignment E=8.8e-07 amino acids 400 to 496 (97 residues), 17.2 bits, see alignment E=2e-06 PF08447: PAS_3" amino acids 282 to 369 (88 residues), 85.8 bits, see alignment E=7.8e-28 PF00989: PAS" amino acids 390 to 450 (61 residues), 36 bits, see alignment 2.5e-12 PF13188: PAS_8" amino acids 391 to 450 (60 residues), 18.1 bits, see alignment 8.2e-07 PF08448: PAS_4" amino acids 394 to 498 (105 residues), 23.7 bits, see alignment E=1.9e-08 PF00512: HisKA" amino acids 516 to 601 (86 residues), 29.3 bits, see alignment E=2.8e-10 PF02518: HATPase_c" amino acids 654 to 765 (112 residues), 91.9 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2249)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQS3 at UniProt or InterPro

Protein Sequence (771 amino acids)

>DvMF_2249 signal transduction histidine kinase, nitrogen specific, NtrB (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSNTTASKGISVPDIIKGRSLSRDLTVSLVVMVLVVVAALFSFVYVQISRDMLHEVDRKA
DEYITRLADILSIPMWNFDARTMDQIGSVFAQYELINEIHIEDAQGNTLFRVRKGADPDA
TVFRERAVRFESEVIGRVSMVVTLQEYRRSLERLLKASALIMGSVLVVLLASTGVLLRVF
LRRPLEALRSGMDQIARGDFAYDMGSIAHAELAQIAENFSRMCSQVEQRENELHAINTKL
QDEIQSRRQTELALRASEERYALVVGGTSDGIWDWDLTTNTVYFSPRWKSIIGYEDHEIP
NRPDEWKGRVHPDDLDAVLHAHDDYLARRVPEFQVEYRMRHKDDSYRWILGRGAALWDVN
GVPVRMAGAHTDITTRKEVEQELREAKNNLDNILNAMPSIIVGVDQAGSITLWNRTAERV
TSLSRDAVLGRPVGEALPDFGFLLDEIRRSIAEGGTIALDKTPVPGPGVTRYFDIVIYPV
VSRGSFGAVVRLDDITGRIRIEEMMVQTEKMLSVGGLAAGMAHEINNPLGGILQGAQNIQ
RRLDPDFAPNVVAAEESGCSMDSIRGYLDRRGILRFLEGIRESGNRAANIVSNMLEFSRR
SESRWQRVSLPYLVDRTLELAANDYDLKKKYDFRHIDIVRDFAADLPDLPCMPTEIEQVL
LNLFKNAAQAMHLRGDRPDPPRISVSLRHEGGMLRIDVADNGPGMEEDVRRRVFEPFFTT
KSVGEGTGLGLSVSYFIITTNHGGTFTVESEPGRGTVFTLRLPVDQRHVTT