Protein Info for DvMF_2209 in Desulfovibrio vulgaris Miyazaki F

Annotation: MotA/TolQ/ExbB proton channel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details PF01618: MotA_ExbB" amino acids 100 to 219 (120 residues), 119.1 bits, see alignment E=5.4e-39

Best Hits

Swiss-Prot: 42% identical to YTXD_BACME: Uncharacterized 29.3 kDa protein in ccpA 3'region (ytxD) from Bacillus megaterium

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to dvm:DvMF_2209)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQN3 at UniProt or InterPro

Protein Sequence (252 amino acids)

>DvMF_2209 MotA/TolQ/ExbB proton channel (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDLATVLGILISFGLIGTALSMGGNPLFFVDSAALLIVLGGTLGAALVHYPLPVALRVLS
ITRKAFATRLHRIDLVIDQFMEFAHRARREGLLSLEPAVRNLDDPFLRKGLQLTIDGLEP
DAIREIMESEIAALETRHSMGVDIFNALASYAPALGLVGTLIGLVQMLRSMNDPSAIGPA
MAVALITTFYGVVLANLVFLPLAGKLRHRSKEEVQLMEMQLEGILAIARGENPRIILEKL
SCYQPPRERRTS