Protein Info for DvMF_2194 in Desulfovibrio vulgaris Miyazaki F

Annotation: permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 248 to 259 (12 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 339 to 363 (25 residues), see Phobius details PF03773: ArsP_1" amino acids 8 to 358 (351 residues), 147.8 bits, see alignment E=2e-47

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to dvm:DvMF_2194)

Predicted SEED Role

"permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQL8 at UniProt or InterPro

Protein Sequence (365 amino acids)

>DvMF_2194 permease (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDVRLIHLAQTALAVFLEALPFLVLGSLVSACMEVFVPRAWVERRVPKSLPGALAFGVAL
GTVLPTCECGVVPVVRRMMGKGVPVPAAVAYMLAAPVVNPVVMVSTWVAFRGDMLMTGLR
AAVVAATAVAVGISVRRMVVGGALRAHVSGGPDACGCGCGHDDAEFGHAHAGPASGPASG
QGGGQGGAQAPLLPQFSEVQAAMMAVPAASAAAGAASPTLIPPAAAVSRAAQVHGVARHM
TADLLDACAWLLPGALAAAAFRTFTPPEALFLFMDTPALAIPALMGLAVLLSVCSEADAF
VAASFVGFPASARLAFVALGPMLDLKLMAMYGAAFRRGLVLRLVVLPTLCVWAACMLLAG
LGVPE