Protein Info for DvMF_2173 in Desulfovibrio vulgaris Miyazaki F

Annotation: branched-chain amino acid transport (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details PF05437: AzlD" amino acids 6 to 103 (98 residues), 93.4 bits, see alignment E=4.1e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2173)

Predicted SEED Role

"Branched-chain amino acid transport protein azlD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQJ7 at UniProt or InterPro

Protein Sequence (108 amino acids)

>DvMF_2173 branched-chain amino acid transport (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTTTFFLMLCGMLAVTYIPRAVPLQLLSQRELNPVITRWLSFVPPAVLAALLAPDLIVKQ
GAVHITADNLYLLAAVPATLVAWRTGSFFGTIAVGMAAVACARWFGMA