Protein Info for DvMF_2155 in Desulfovibrio vulgaris Miyazaki F

Annotation: ABC-2 type transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 32 to 42 (11 residues), see Phobius details amino acids 67 to 70 (4 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 320 to 344 (25 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 38 to 400 (363 residues), 43.7 bits, see alignment E=3.2e-15 PF12698: ABC2_membrane_3" amino acids 58 to 426 (369 residues), 143.8 bits, see alignment E=1.1e-45 PF01061: ABC2_membrane" amino acids 243 to 399 (157 residues), 91.5 bits, see alignment E=8.8e-30

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to dvm:DvMF_2155)

Predicted SEED Role

"ABC transport system, permease component YbhR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQH9 at UniProt or InterPro

Protein Sequence (435 amino acids)

>DvMF_2155 ABC-2 type transporter (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHDRTTASPPARTSSQPDRYDRHSAQSGPLALLHRLLALIAKEFLTLLKDPKSRTVVILP
PLLQTIIFGYAATFDLVDVPCAIYDEDRSAASRELAARVAGSPTFRVVEYLHRDADMARL
LDAGQVRLVLRIGQGFERALTLRGGVGQPAAADAGSGMEPSGTAATSTIPAPAPSVAPSQ
AVVQAVADGRNSNTAGLALNYMASIVDDFGARYVAAHGGQPRPSTLLTRAWHNPNLLSRW
FFVPGIVVMVTMVVTLIITALSVAREREQGTFDQMLVTPYRPTELLIGKAAPGFLVGLFE
ASLIVAMAVLWFGVPLRGSLLTLYAGLVLFLFSVVGIGLMISSLSVTMQQGLLGMFLFTM
PAAILSGFATPIANMAEPVQWLTLVNPMRYILIVVRGVFLEGADLTLLAPQLWPLALIGA
VCMAAAGWLFRHRIQ