Protein Info for DvMF_2143 in Desulfovibrio vulgaris Miyazaki F

Annotation: dihydroorotate dehydrogenase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR01037: dihydroorotate dehydrogenase family protein" amino acids 13 to 302 (290 residues), 338.4 bits, see alignment E=1.6e-105 PF01180: DHO_dh" amino acids 15 to 288 (274 residues), 244 bits, see alignment E=4e-76 PF03060: NMO" amino acids 217 to 272 (56 residues), 29.7 bits, see alignment E=8.8e-11 PF00977: His_biosynth" amino acids 226 to 296 (71 residues), 25 bits, see alignment E=2.4e-09

Best Hits

Swiss-Prot: 72% identical to PYRDB_DESMR: Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit (pyrD) from Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 100% identity to dvm:DvMF_2143)

MetaCyc: 50% identical to dihydroorotate dehydrogenase (catalytic subunit) (Bacillus subtilis subtilis 168)
Orotate reductase (NADH). [EC: 1.3.1.14]

Predicted SEED Role

"Dihydroorotate dehydrogenase, catalytic subunit (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.3.1

Use Curated BLAST to search for 1.3.1.14 or 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQG7 at UniProt or InterPro

Protein Sequence (308 amino acids)

>DvMF_2143 dihydroorotate dehydrogenase family protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MIDMHVTLPGGLHPLTLNNPVMTASGTFGYGVEFTPYGDLTKLGGIVVKGLSLAPRRGNP
MPRVAETPCGMLNAVGLQNDGVDYFVRTTLPKLPWREVPIVANLYACDPGEFGELAAVLA
AEEGVAALEVNISCPNVKEGGVIFGQDPRQAAKVTEAVKMRAGSKPVIVKLSPNVTDIAH
MARAVEDAGADVLSCINTLTGMGVDINTRKPLLANVVGGLSGPAIKPVALRCVWQAAKAV
SIPVIGIGGITSAEDVLEFLLVGAHAVQVGTANFIRPDFVFRLVDDLAALCERMGIEQWD
DFRGTLKV