Protein Info for DvMF_2137 in Desulfovibrio vulgaris Miyazaki F

Annotation: TRAP dicarboxylate transporter, DctM subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 58 to 76 (19 residues), see Phobius details amino acids 83 to 110 (28 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 244 to 260 (17 residues), see Phobius details amino acids 272 to 298 (27 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 340 to 390 (51 residues), see Phobius details amino acids 401 to 425 (25 residues), see Phobius details PF06808: DctM" amino acids 7 to 420 (414 residues), 386.4 bits, see alignment E=7.9e-120 TIGR00786: TRAP transporter, DctM subunit" amino acids 19 to 425 (407 residues), 416.8 bits, see alignment E=4e-129

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2137)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQG1 at UniProt or InterPro

Protein Sequence (427 amino acids)

>DvMF_2137 TRAP dicarboxylate transporter, DctM subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MVGLILFGGMVLLFALNAPVAVALGGAAFAAVLAKGLTMPVGLEPMLAVQRLYAGADSFP
LLAVPLFMLAGELMSAGGISRRIVALADALVGHLPGGLAAVSVVSAMFFAGVSGSAAADT
AAVGSILIPAMIRRGYPAPLAGAVQAAGGCIGVIIPPSIPMIVFGALTGASIGRLFAGGV
LPGLLMGASLVALCVVEARRTGRVPERRFDARALWPAIRSGAWALGAPAIILGTIIGGVA
TATESAAMAVAYALPVGLYAHRELRWRDLPRLALCAGVTSAVVMLIIAAASLFGWVMALE
RLPQAIAAWMLSLSGDRIVLLLLVNLLLLVVGAFLETTAAILLFVPVLVPLLPALGIDLV
HLGVIVVVNLAIGMLTPPLGVCLVVSCSIARIPLSAISRAIVPMLVVLIVDLLLVTFFPP
LVLWLGG