Protein Info for DvMF_2132 in Desulfovibrio vulgaris Miyazaki F

Name: infA
Annotation: translation initiation factor IF-1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00008: translation initiation factor IF-1
  • amino acids 3 to 71 (69 residues), 128 bits, E=5e-42
• PF01176: eIF-1a
  • amino acids 7 to 70 (64 residues), 104.5 bits, E=9.3e-35

Best Hits

Swiss-Prot: 97% identical to IF12_DESVV: Translation initiation factor IF-1 2 (infA2) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K02518, translation initiation factor IF-1 (inferred from 92% identity to dde:Dde_3769)

Predicted SEED Role

"Translation initiation factor 1"

Sequence Analysis Tools

See B8DQF6 at UniProt or InterPro

Protein Sequence (72 amino acids)

>DvMF_2132 translation initiation factor IF-1 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MAKEDAIEVDGVVQEALPNAMFRVELENGHEVLAHISGKMRKFYIRILPGDRVKVELSPY
DLTRGRITYRMK