Protein Info for DvMF_2128 in Desulfovibrio vulgaris Miyazaki F

Annotation: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02441: Flavoprotein" amino acids 2 to 178 (177 residues), 141.2 bits, see alignment E=1.2e-45 TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases" amino acids 3 to 189 (187 residues), 213 bits, see alignment E=1.4e-67

Best Hits

Swiss-Prot: 54% identical to UBIX_ECO57: Flavin prenyltransferase UbiX (ubiX) from Escherichia coli O157:H7

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 100% identity to dvm:DvMF_2128)

MetaCyc: 54% identical to flavin prenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"UbiX family decarboxylase associated with menaquinone via futalosine"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQF2 at UniProt or InterPro

Protein Sequence (196 amino acids)

>DvMF_2128 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKRFVVGISGASGMPLAVTLLRGLRNAAPALPGGVQVHLVVSDAARQVLALESDLRAEDL
LALANVVHDARDFGAPPSSGSWPHDGMVVCPCSMSTLAAIAHGTGSNLLHRAADVTLKER
RPLVLVVRETPVSRVHLRNMLAAAEAGAVIMPPCPGFYARPASVQDILDHLAGRILDQIG
VPNTLAARWGEAADTE