Protein Info for DvMF_2108 in Desulfovibrio vulgaris Miyazaki F

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF00672: HAMP" amino acids 201 to 252 (52 residues), 27 bits, see alignment 7e-10 PF00512: HisKA" amino acids 269 to 356 (88 residues), 34 bits, see alignment E=3.8e-12 PF02518: HATPase_c" amino acids 465 to 552 (88 residues), 73.7 bits, see alignment E=2.5e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2108)

Predicted SEED Role

"integral membrane sensor signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQD2 at UniProt or InterPro

Protein Sequence (562 amino acids)

>DvMF_2108 integral membrane sensor signal transduction histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQFLIRRLAAGNIRQLVLFGISVSILGFSLLGGLSYNYLLQIEDALALAEVVDDLSSDIL
EIRRYEKNYLLYAMEEDHAENLVFIGRALDVIERIEPGGGGVQGTDLRGSDGLRALRRDL
HGYRDTFSRLGEVQLAGQLRERERGALREDLREQGKALVAQARQIVTYQRERILGIVGSL
KHQLLLSIGAMVGLATFFSWLIGRRILGALSVIERSARQIVQGSLEQLPLPATSDETRGV
VEAFNHMLVELEHRQNQLVQEKKLASLGVLTSGIAHQLNNPLNNISTSCQILREELRYAT
GGNGVDGGPGQTGGSGGAGGTGALDSALAGRMLENIHQEVHRSRDIVKGLLEFSRETEFS
LKPVALRDVVGRSVALVASEVPACIAIDAEVPGDIVLPLDVQRFQEVLLNLLINAIQAVQ
AAQERVGNAPEGSMADGSAPEGDMPDEKGPDEKRPDGAMPDGACPRAGAITVTAARDVAA
RQVVLRVADTGIGIGPEHLGRIFDPFFTLKEVGKGTGLGLSVAFGIIRKHGGSIGVESTP
GAGTCFTIRLPLGAPEPTGDAA