Protein Info for DvMF_2103 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF81 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 178 to 203 (26 residues), see Phobius details amino acids 209 to 236 (28 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 314 to 338 (25 residues), see Phobius details PF01925: TauE" amino acids 22 to 288 (267 residues), 129.3 bits, see alignment E=9.5e-42

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to dvm:DvMF_2103)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQC7 at UniProt or InterPro

Protein Sequence (352 amino acids)

>DvMF_2103 protein of unknown function DUF81 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDILALDPTKFIDLTASGICFLFLVGFIGGLVSGFIGSGGAFVLTPGMMSLGVPGTVAVA
SNMCHKFPKALVGAIKRFRYGQVDVKLGLVMAASAAVGVQIGIRIQQVILEKWGQVGSDL
YVSLSFVAVLVLVGGYVMRDALRCARCGGVETTAPLALRLQAIELPPMLTFRRSGIRISL
WFTLPVGFATGMLAATIAVGGFIGVPGMIYVMGVPGLMASATELVIAFVMGLGGSINWAM
HGMVDIRLVLIILGGSLLGVQLGAIGTTYVREHMIKMVMAVIMLIVAVSRGIALPRYLVK
LGFMDMSPEMLDVLGKISFASMCLALLTGAVIILGSMWKGRAAAREEAHGQA