Protein Info for DvMF_2053 in Desulfovibrio vulgaris Miyazaki F

Annotation: S-adenosylmethionine/tRNA-ribosyltransferase- isomerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 PF02547: Queuosine_synth" amino acids 34 to 416 (383 residues), 396.9 bits, see alignment E=3.4e-123 TIGR00113: S-adenosylmethionine:tRNA ribosyltransferase-isomerase" amino acids 161 to 416 (256 residues), 273.6 bits, see alignment E=1.1e-85

Best Hits

KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 100% identity to dvm:DvMF_2053)

Predicted SEED Role

"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMP0 at UniProt or InterPro

Protein Sequence (417 amino acids)

>DvMF_2053 S-adenosylmethionine/tRNA-ribosyltransferase- isomerase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRMDETMGNTGHEQMHDTTGTGADANGIPEDDRLESYRFHLPEDQIAQHPAPERGGSRLL
VLDRRTMEKGSAAALTHAHFADLCDHLPEGCLLVANNSKVLPARLLGLRPTGGKVEFLLL
TPLPLLEELARSDAGAGSGRPSTGNGLRDEGAGWRSVPAEGLLRASKKIRPGDVMDFGPH
LRVEVIQPGDFGRSAVRLHWMGDLRQLFLQQGHLPLPPYIRRETGVSSSDAQEDRDRYQT
VYADDSRLGSVAAPTAGLHFTDDLRARLAATDRKWAEVTLYVGYGTFSPVRCADIRQHAM
HREYIEVSEATAAAIRAAKAEGRPVVTVGTTSTRTLEGTVRACGEVRAFTGWTDIFIKPG
YRFTVADHIITNFHLPESSLLMLVSAFAGRTRVLSAYAEAVARGYRFFSYGDAMLLL