Protein Info for DvMF_2037 in Desulfovibrio vulgaris Miyazaki F

Name: hisS
Annotation: histidyl-tRNA synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR00442: histidine--tRNA ligase" amino acids 20 to 418 (399 residues), 478.3 bits, see alignment E=1e-147 PF13393: tRNA-synt_His" amino acids 23 to 326 (304 residues), 142.3 bits, see alignment E=4.2e-45 PF01409: tRNA-synt_2d" amino acids 33 to 172 (140 residues), 29 bits, see alignment E=1.5e-10 PF00587: tRNA-synt_2b" amino acids 81 to 311 (231 residues), 59 bits, see alignment E=1.3e-19 PF03129: HGTP_anticodon" amino acids 340 to 424 (85 residues), 39.2 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 77% identical to SYH_DESVV: Histidine--tRNA ligase (hisS) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to dvm:DvMF_2037)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMM4 at UniProt or InterPro

Protein Sequence (426 amino acids)

>DvMF_2037 histidyl-tRNA synthetase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSTNNSDKTAQKVTGDKVGTIKGFADMFSPDSDVFTFMENTAREVFGRYGYAELRTPLLE
RTELFCRSIGTETDVVQKEMYTFPDRKGRSLTLRPEATAGVMRAFIDAGRHAQEPVSKLF
TTGPMFRYERPQKGRMRQFHQINCECLGPQEPQADAELVLMLMTFLRELGLTDLSLQVNS
LGCRECRPVYRAALRDFLDSIDRESLCEDCRRRIDTNPLRVLDCKVPTCRELTAEAPRII
DHNCPECRSHFDTVLRVFDAAQLPYVLTPRLVRGLDYYNRTTFEVVSGSIGAQSSVAGGG
RYDGLVAQLGGPDVPGVGFACGMERLALMMPALEKKRPDFYIAVLDPAAADAAMLLAQEL
RAAGKAGEVSFAARGIKGQMRQAGRTGARCTLLLGGDEMANGTVVIKDMDSGEQRSVPQG
EAANHV