Protein Info for DvMF_1992 in Desulfovibrio vulgaris Miyazaki F

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 35 to 42 (8 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details PF00512: HisKA" amino acids 145 to 209 (65 residues), 48.9 bits, see alignment E=5.6e-17 PF02518: HATPase_c" amino acids 254 to 364 (111 residues), 82.6 bits, see alignment E=2.9e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1992)

Predicted SEED Role

"Sensor protein of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ71 at UniProt or InterPro

Protein Sequence (372 amino acids)

>DvMF_1992 integral membrane sensor signal transduction histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MVNWILPRVVRFRPSLRVRIGLLLAALAATSMAAAALPLLMASGRLSLPTPFGTWTADPA
TDALGLMLLVLFLAGLLAVVVFRQVLGPIRRLALEGLEDADAYGNEVEVLDRRLRHLLDT
MHRTQVQLEESHETLRQTEKLALVGKLAAGVAHSIRNPLTSVKLRLFALERSLKLGPDQK
EQQEDFEVIAAEIRHLDAIVTNFLEFSRRPRLRMQPVSPSDVVDMTLQLLKHRLESFNVA
VAVHRAERLPVVDGDAEQLKEALVNLILNACEAMGYDGTLDITEEKGIINPLGRAVVIRI
ADSGPGVPQHIREEVFQPFFSTKEEGTGLGLPIARRIFEEHGGWLHLHSAHGKGATFVIV
LPARKDDSWLRS