Protein Info for DvMF_1982 in Desulfovibrio vulgaris Miyazaki F

Annotation: multi-sensor hybrid histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1058 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 114 to 136 (23 residues), see Phobius details PF01590: GAF" amino acids 165 to 340 (176 residues), 34.8 bits, see alignment E=9e-12 TIGR00229: PAS domain S-box protein" amino acids 352 to 474 (123 residues), 42.5 bits, see alignment E=3.4e-15 amino acids 476 to 601 (126 residues), 62.6 bits, see alignment E=2e-21 PF13188: PAS_8" amino acids 356 to 413 (58 residues), 19.1 bits, see alignment 3.8e-07 amino acids 480 to 533 (54 residues), 25.9 bits, see alignment 2.8e-09 PF00989: PAS" amino acids 480 to 575 (96 residues), 39.7 bits, see alignment E=1.8e-13 PF08448: PAS_4" amino acids 485 to 595 (111 residues), 28.7 bits, see alignment E=5.2e-10 PF13426: PAS_9" amino acids 490 to 591 (102 residues), 31.6 bits, see alignment E=6.9e-11 PF00512: HisKA" amino acids 615 to 679 (65 residues), 70.8 bits, see alignment 3.1e-23 PF02518: HATPase_c" amino acids 726 to 841 (116 residues), 103.9 bits, see alignment E=2.8e-33 PF00072: Response_reg" amino acids 867 to 934 (68 residues), 56.2 bits, see alignment 1.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1982)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ61 at UniProt or InterPro

Protein Sequence (1058 amino acids)

>DvMF_1982 multi-sensor hybrid histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPSVHHSGAASVAVRLVALALAIVLCGTVSYRTAAASGTAVPLDPALHAPETVRAATPSP
TSPPASPSPPSILSSLSVLFSRPLGAMASATSDALSGTASQAVPTGVQPPAPWWMRLIDD
AALVLPAAALLLWLTLRLRRTRRALNRAENTLGSIVQVTSPLVEQEFFRVLVQQLAHALG
ARYALVGELGDPGKQGKQGKQGESARLAGQTEQASQAHQARQVSQASQDGGKADDDYLRV
LAAWLGDAPGEPFDYALHGTPCARVLNSPDLCVYPDGVQENFPEAELHASLGIRSYMGLA
LRDARGTPLGVLAVFHDLPMAPPTGESMALMRILAGRATAELERLRAGRALRESEARYRG
LFENNHVVALLIDPTTKAIRDASPAAAEFYGWPRDVLRTMHISDINTLPPGTLHGELSSA
ARGERQRFRFRHRLANGTTRDVESNTGTLVLHGEPLLYSIITDVTEQRRAEEALRHSELR
LRMLVESAGDAIYLADGAGHILDANPEAEHQTGHTREQLLRMTLFDIDERLDQRVFARLR
AELESARKATFETTHRTRNGTPLPVEVRMAQVEETGEAEGDPLLLAIVRDSSARKRAESE
LRCAKEVAEAASRTKGEFLANMSHEIRTPLNGIMGMLQLLQTDPPKAMRTVYVGAATQSC
RRLGLLLGDILDLSRIEAGKLELHDEPFEARAVLDEVRGLFEGPAAERGLTLRVSVDERI
PRHLRGDAMRLRQVLFNLVGNAVKFTDQGEVVVEAWRVQASRSRGCRVVFTVRDTGIGIA
EERLKDIFEPFVQAETASTRRYQGAGLGLPIVRRLVRLMCGTVTVESTPGAGTAFSVSLP
FRFVNKVEEAVVEPHTADALSLRGRAILLAEDDAVNRLAVTRLLENMGARVTTADNGERA
VQALLTADYDCALMDIQMPVMDGMEATRRLRALAHDGARDSAREGAHEGARAAVEDARAP
GTTGDAPPAEDAEPDAENDAGSDALQDRRIDPRILRARSATPIIALTAHAMRGDREQFLA
AGMDGYLTKPVEAATLASAIVRVIHEQGLREREPEGLH