Protein Info for DvMF_1981 in Desulfovibrio vulgaris Miyazaki F

Annotation: Ferritin Dps family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF02915: Rubrerythrin" amino acids 32 to 159 (128 residues), 41.3 bits, see alignment E=3.1e-14 PF00210: Ferritin" amino acids 32 to 164 (133 residues), 81.1 bits, see alignment E=1.2e-26 PF12902: Ferritin-like" amino acids 34 to 99 (66 residues), 25.3 bits, see alignment E=1.9e-09

Best Hits

Swiss-Prot: 68% identical to BFR_DESDA: Bacterioferritin (bfr) from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)

KEGG orthology group: K03594, bacterioferritin (inferred from 100% identity to dvm:DvMF_1981)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ60 at UniProt or InterPro

Protein Sequence (199 amino acids)

>DvMF_1981 Ferritin Dps family protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MNKATKPAKAKPAKPAAAAPSPREARKAKVIEVLNRARAMELNAITQYMNQHYGLDNMDY
GALAADMKLIAIDEMRHAEMFAERIKELGGEPTTEREGDLVKGQDVQTIFPYDAGLEDDT
IDAYNQFLQVCRENGDSISMKLFETIIEEEQVHFNHFDNVGEHLKNLGDTYLSKIAGTSA
STGPSTKGFLISKGGAAAG